Application

Rabbit Anti-EBF3 antibody can be used for western blot applications at concentration of 2.5µg/ml.

Biochem/physiol Actions

EB1 family proteins are evolutionarily conserved proteins that bind microtubule plus-ends and centrosomes and regulate the dynamics and organization of microtubules. Human EB1 family proteins, which include EB1, EBF3, and RP1, also associate with the tumor suppressor protein adenomatous polyposis coli (APC) and p150glued, a component of the dynactin complex.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

EBF3 is known to function as a tumor suppressor that can induce cell cycle arrest and apoptosis. EBF3 can also function as a prognostic indicator in gastric carcinoma.Rabbit Anti-EBF3 antibody recognizes human, mouse, rat, canine, and zebrafish EBF3.

Immunogen

Synthetic peptide directed towards the middle region of human EBF3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: AHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQ