Anti-DTX2

Code: AV43285-100UL D2-231

Biochem/physiol Actions

DTX2 is a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determin...


 Read more

Your Price
€381.00 100UL
€468.63 inc. VAT

Biochem/physiol Actions

DTX2 is a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. DTX2 probably acts both as a positive and negative regulator of Notch, depending on the developmental and cell context and mediates the antineural activity of Notch, possibly by inhibiting the transcriptional activation mediated by MATCH1. It also functions as an ubiquitin ligase protein in vitro, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human DTX2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: EDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLE

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... DTX2(113878)
mol wt62 kDa
NCBI accession no.NP_065943
Quality Level100
shipped inwet ice
species reactivityhorse, mouse, guinea pig, human, bovine, dog, rabbit, rat, goat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q6XM87
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.