Anti-DNAJB1

Code: SAB2100604-100UL D2-231

Application

Anti-DNAJB1 antibody produced in rabbit has been used in western blotting (1:500).

Biochem/physiol Actions

DnaJ (Hsp40) homolog, subf...


 Read more

Your Price
€508.00 100UL
€624.84 inc. VAT

Application

Anti-DNAJB1 antibody produced in rabbit has been used in western blotting (1:500).

Biochem/physiol Actions

DnaJ (Hsp40) homolog, subfamily B, member 1 (DNAJB1) interacts with heat shock protein 70 (HSP70) and can stimulate its ATPase activity. It stimulates the association between heat shock cognate 70 kDa protein (HSC70) and Hsc70-interacting protein (HIP). In association with HSP70, HSP40 favors adenosine triphosphate (ATP)-dependent protein refolding, transport, and interaction. It acts as a negative regulator melanoma differentiation-associated gene 5 (MDA5) based mitochondrial antiviral signaling protein pathway and mitogen-inducible gene 6 (MIG6). It also blocks p53 mediated apoptosis by destabilizing programmed cell death 5 (PDCD5). Hsp40 mediates viral ribonucleoproteins (vRNPs) import and may serve as a potential antiviral target.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

DnaJ (Hsp40) homolog, subfamily B, member 1 (DNAJB1) belongs to the heat shock protein 40 (HSP40) protein family. It contains a highly conserved J domain. The DNAJB1 gene is mapped to human chromosome 19p13.12.

Immunogen

Synthetic peptide directed towards the N terminal region of human DNAJB1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: GSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEE

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... DNAJB1(3337)
mol wt38 kDa
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P25685
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.