Biochem/physiol Actions

Cysteine and glycine rich protein 1 (CSRP1) is a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Other genes in the family include CSRP2 and CSRP3. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.LIM domain of CSRP1 is involved in smooth muscle differentiation and protein dimerization. CSRP1 modulates actin filament bundling. It acts as a stress response factor and is involved in growth inhibitory and cytoprotective functions.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Cysteine and glycine rich protein 1 (CSRP1) is expressed in smooth muscles. The gene is located on human chromosome 1q32.1.

Immunogen

Synthetic peptide directed towards the middle region of human CSRP1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: YGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCP