Application

Rabbit Anti-CNOT3 antibody can be used for western blot applications at a concentration of 0.5 µg/ml.

Biochem/physiol Actions

CNOT3 is a protein component of CCR4-NOT protein complex. Yeast CCR$-NOT is a global regulator of RNA polymerase II transcription. It is comprised of yeast NOT1 to NOT5, yeast CCR4 and additional proteins like yeast CAF1.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

CNOT3 is a subunit of the CCR4-NOT transcription complex. This subunit can bind to the PRPF31 promoter and mediate transcriptional repression. It acts as a modifier gene and controls the effects of PRPF31 mutations in retinitis pigmentosa. CNOT3 mutations have also been implicated in T-cell acute lymphoblastic leukemia (T-ALL).Rabbit Anti-CNOT3 antibody recognizes bovine, human, mouse, rat, zebrafish, canine, and rabbit CNOT3.

Immunogen

Synthetic peptide directed towards the N terminal region of human CNOT3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: QFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHVRMLETILRML