Application

Anti-CISD2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions

CISD2 (nutrient-deprivation autophagy factor-1, NAF-1) is a zinc finger protein that belongs to the novel Fe-S protein NEET family. It localizes to endoplasmic reticulum and inner mitochondrial membrane and is involved in calcium homeostasis and suppresses beclin-1-dependent autophagy. Mutations in CISD2 gene have been implicated in Wolfram Syndrome 1 and developmental delays.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human CISD2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALL