Application
Anti-CHRNB2 antibody produced in rabbit is suitable for western blotting at a concentration of 1 µg/ml.
Biochem/physiol Actions
CHRNB2 is a transmembrane, oligomeric, ligand-gated nicotinic receptor that induces ion channel opening for the movement of positive ions when it is activated by cholinergic binding. Nicotinic acetylcholine receptors mediate presynaptic, postsynaptic and extrasynaptic signaling. Mutations in gene that codes for CHRNB2 have been observed in autosomal dominant nocturnal frontal lobe epilepsy and memory deficits.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the N terminal region of human CHRNB2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISV
This product has met the following criteria to qualify for the following awards: