Anti-CHAC2

Code: SAB2104121-100UL D2-231

Application

Anti-CHAC2, (N-terminal) antibody produced in rabbit has been used in western blot.

Biochem/physiol Actions

Glutathione-specific γ-gl...


 Read more

Your Price
€528.00 100UL
€649.44 inc. VAT

Application

Anti-CHAC2, (N-terminal) antibody produced in rabbit has been used in western blot.

Biochem/physiol Actions

Glutathione-specific γ-glutamylcyclotransferase 2 (ChaC2) helps in degrading glutathione in the cytosol of mammals. In pathways that are independent of ChaC1, ChaC2 would disrupt the expression of nuclear erythroid-2-like factor (Nrf2) and glutamate cysteine ligase. Upregulation of ChaC2 gene can prevent the proliferation of cells. It may be considered as a candidate tumor suppressor gene (TSG) in gastrointestinal cancer.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Glutathione-specific γ-glutamylcyclotransferase 2 (ChaC2) belongs to the ChaC family of γ-glutamylcyclotransferases. It carries a methionine (Met) residue at theN-terminus.

Immunogen

Synthetic peptide directed towards the N terminal region of human CHAC2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVV

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... CHAC2(494143)
mol wt21 kDa
NCBI accession no.NM_001008708
Quality Level100
shipped inwet ice
species reactivitymouse, bovine, dog, human, guinea pig, rat, rabbit
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q8WUX2
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.