Application
Anti-CDH3 polyclonal antibody is used to tag placental-specific cadherin proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of P-cadherin in cell adhesion and protein:protein interactions.
Biochem/physiol Actions
CDH3 is a classical cadherin from the cadherin superfamily. The protein is a calcium-dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Its gene is located in a six-cadherin cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer. In addition, aberrant expression of this protein is observed in cervical adenocarcinomas. Mutations in its gene have been associated with congential hypotrichosis with juvenile macular dystrophy.This gene is a classical cadherin from the cadherin superfamily. The encoded protein is a calcium-dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. This gene is located in a six-cadherin cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer. In addition, aberrant expression of this protein is observed in cervical adenocarcinomas. Mutations in this gene have been associated with congential hypotrichosis with juvenile macular dystrophy.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Cadherins, calcium-dependent adhesion molecules, are a class of type-1 transmembrane proteins involved in cell adhesion where in they ensure that cells within tissues are bound together. P-cadherin (placental) (CDH3) is an adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. CDH3 (gene) interacts with other molecules including CDH1, β-catenin, plakoglobin, nephrin and catenin (cadherin-associated protein), α 1. Mutated P-cadherin (placental) has been associated with congential hypotrichosis with juvenile macular dystrophy.
Immunogen
Synthetic peptide directed towards the N terminal region of human CDH3
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQ
Specificity
Anti-CDH3 polyclonal antibody reacts with pig, mouse, human, and bovine P-cadherin proteins.
This product has met the following criteria to qualify for the following awards: