Anti-CBX4

Code: AV30002-100UL D2-231

Application

Anti-CBX4 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 µg/ml. For immunohistochemistry of paraffin-embedded tissue ...


 Read more

Your Price
€381.00 100UL
€468.63 inc. VAT

Application

Anti-CBX4 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 µg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 µg/ml is suitable.

Biochem/physiol Actions

CBX4 belongs to the Polycomb group of proteins that are involved in determining stem cell pluripotency, identity and epigenetic gene silencing. CBX4 exhibits E3 sumo ligase activity that is directly involved in DNA damage response pathway. It interacts with p63 and regulates the transcription of genes that maintain the stemness of epithelial progenitors. CBX4 has a non-redundant role in T-cell proliferation and thymic organogenesis.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human CBX4

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTD

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... CBX4(8535)
mol wt61 kDa
NCBI accession no.NP_003646
Quality Level100
shipped inwet ice
species reactivitybovine, mouse, dog, human, rat, guinea pig, rabbit
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.O00257-2
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.