Anti-CACNG4

Code: AV35236-100UL D2-231

Application

Rabbit Anti-CACNG4 antibody is suitable for western blot applications at a concentration of 1 µg/ml.

Biochem/physiol Actions

L-t...


 Read more

Your Price
€381.00 100UL
€468.63 inc. VAT

Application

Rabbit Anti-CACNG4 antibody is suitable for western blot applications at a concentration of 1 µg/ml.

Biochem/physiol Actions

L-type calcium channels are composed of five subunits. CACNG4 represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family.L-type calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes.L-type calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

CACNG4 is a type I transmembrane AMPA receptor regulatory protein (TARP). Studies have reported that targeted disruption in CACNG4 gene exaggerates spike-wave seizures in stargazer mouse.Rabbit Anti-CACNG4 antibody recognizes chicken, zebrafish, bovine, human, mouse, and rat CACNG4.

Immunogen

Synthetic peptide directed towards the N terminal region of human CACNG4

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... CACNG4(27092)
mol wt36 kDa
NCBI accession no.NP_055220
Quality Level100
shipped inwet ice
species reactivityrat, bovine, human, horse, mouse, guinea pig, rabbit
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9UBN1
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.