Biochem/physiol Actions

The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Voltage-dependent L-type calcium channel subunit β-3 (CACNB3) is the β subunit critical for proper functioning of the voltage-dependent L-type calcium channel by increasing calcium current. It is a 54 kDa protein shown to be critical for renal and cardiac cell functioning as well as the survival of CD8+ T lymphocytes.

Immunogen

Synthetic peptide directed towards the C terminal region of human CACNB3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: EHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPH