Application

Rabbit Anti-C14ORF166 antibody is suitable for western blot applications at a concentration of 0.125 µg/ml.

Biochem/physiol Actions

The function of the C14orf266 gene has not yet been determined.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

C14ORF166 (CLE) is known to interact with influenza virus polymerase and HCV (Hepatitis C Virus) core protein during viral replication and assembly.Rabbit Anti-C14ORF166 antibody recognizes bovine, human, mouse, rat, and canine C14ORF166.

Immunogen

Synthetic peptide directed towards the N terminal region of human C14orf166

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: GLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGV