Application
Anti-Butyrophilin-1A1 polyclonal antibody is used to tag Btn1a1 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of Btn1a1 in lactation.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.Immunofluorescence (1 paper)
Biochem/physiol Actions
Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families.Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Butyrophilin, subfamily 1, member A1, a BTN family member, is found in mammary tissue, spleen and thymus. Butyrophilin 1a1 (Btn1a1) is highly expressed in the lactating mammary gland and is secreted into milk in association with lipid droplets. Btn1a1 functions either as a structural protein or as a signaling receptor by binding to xanthine dehydrogenase/oxidase.
Immunogen
Synthetic peptide directed towards the N terminal region of human BTN1A1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LPCRLSPNASAEHLELRWFRKKVSPAVLVHRDGREQEAEQMPEYRGRATL
Specificity
Anti-Butyrophilin-1A1 polyclonal antibody reacts with human Butyrophilin-1A1 proteins.
This product has met the following criteria to qualify for the following awards: