Application
Anti-ATG16L1 (AB1) antibody produced in rabbit is suitable for western blot analysis.
Biochem/physiol Actions
ATG16L1 (autophagy related 16-like 1) is an autophagy-related (ATG) protein. It plays an essential role as a component of the ATG12-ATG5-ATG16L1 complex during autophagy. It functions as a molecular scaffold to form the autophagosome in response to classical and pathogen-related autophagy stimuli. The complex introduces LC3 (ATG8 in yeast) to the autophagosome and connects it to the phosphatidylethanolamine (PE). This conjugation generates a membrane-bound activated form of LC3 named LC3-II.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the N terminal region of human ATG16L1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQ
This product has met the following criteria to qualify for the following awards: