Application
Anti-ASB5 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.
Biochem/physiol Actions
Ankyrin repeat and SOCS box containing 5 (ASB5) belongs to the ankyrin repeat and SOCS box-containing (ASB) family of proteins. These proteins regulate protein turnover by targeting proteins for polyubiquitination and proteasome-mediated degradation. It is expressed in endothelial cells and smooth muscle cells and is involved in arteriogenesis.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the C terminal region of human ASB5
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC
This product has met the following criteria to qualify for the following awards: