Application

Anti-APOA4 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Biochem/physiol Actions

Apolipoprotein A-IV (Apo A-IV) is a lipid transport system protein present along with the chylomicrons, high-density lipoprotein (HDL) and the lipoprotein-free fraction of the plasma.It plays a pivotal role in lipoprotein metabolism and reverse cholesterol transport. Apo A-IV decreases the Glc-6-Pase and phosphoenolpyruvate carboxykinase (PEPCK) gene expression via nuclear receptor NR1D1 and hence facilitates the inhibition of hepatic gluconeogenesis.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

APOA4 gene encodes a 376 amino acid containing protein apolipoprotein A-IV. It consists of 3 exons separated by two introns. It is localized within a short region on chromosome 11q23-q24.

Immunogen

Synthetic peptide directed towards the C terminal region of human APOA4

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: RQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQ