Application
Anti-ADAM7 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.
Biochem/physiol Actions
Adam7 resides in an intracellular compartment of epididymal cells and is transferred to sperm membranes, where its levels are dependent on the expression of Adam2 and Adam3, which play critical roles in fertilization. It functions in fertilization through the formation of a chaperone complex and enhances association with integral membrane protein 2B (Itm2b) during capacitation in sperm. It also helps in the maturation of sperm cells in mammals and also plays a unique secretory feature and interactive relationship with sperm.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
ADAM7 (ADAM metallopeptidase domain 7) gene encodes a single-pass type I membrane protein that belongs to ADAMs family of zinc proteases and is expressed in melanoma cells. It has a role in epididymosomes and is an integral plasma membrane protein in sperm that has unique secretory feature and interactive relationship during epididymis-to-sperm transfer process. Mutation in ADAM7 gene results in melanoma progression.
Immunogen
Synthetic peptide directed towards the C terminal region of human ADAM7
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PTETLGVENKGYFGDEQQIRTEPILPEIHFLNKPASKDSRGIADPNQSAK
This product has met the following criteria to qualify for the following awards: