Application

Rabbit Anti-ACCN3 antibody is suitable for western blot (2.5 µg/ml) and IHC (4-8 µg/ml) applications.

Biochem/physiol Actions

ACCN3 encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. ACCN3 encodes a member that is an acid sensor and may play an important role in the detection of lasting pH changes. In addition, a heteromeric association between this member and ACCN1 has been observed as proton-gated channels sensitive to gadolinium.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

ACCN3 (ASIC3) belongs to the degenerin/epithelial sodium channel (DEG/ENaC) protein family. It is known to function as an acid sensor, as well as a sensor of acidic and inflammatory pain. It is also known to enhance H⁺ gated currents in neurons. ASIC3 has been implicated in ischemic pain and hyperalgesia.Rabbit Anti-ACCN3 antibody recognizes human, mouse, rat, bovine, and canine ACCN3.

Immunogen

Synthetic peptide directed towards the N terminal region of human ACCN3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRL