Anti-ACAT2

Code: AV32790-100UL D2-231

Application

Rabbit Anti-ACAT2 (AB1) antibody can be used for western blot applications at a concentration of 1 µg/ml. It can also be used for IHC applications at 4-8 ...


read more

Your Price
€297.00 100UL
€365.31 inc. VAT

Application

Rabbit Anti-ACAT2 (AB1) antibody can be used for western blot applications at a concentration of 1 µg/ml. It can also be used for IHC applications at 4-8 µg/ml.

Biochem/physiol Actions

Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

ACAT2 is an acyl-coenzyme A cholesterol acyltransferase that regulates the esterification of cholesterol in cells. ACAT2 has been recommended as a treatment target for hypercholesterolemia and atherosclerosis. It has also been implicated in the inhibition of apoB secretion in liver cells.Rabbit Anti-ACAT2 (AB1) antibody recognizes bovine, human, mouse, and rat ACAT2.

Immunogen

Synthetic peptide directed towards the middle region of human ACAT2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ACAT2(39)
mol wt41 kDa
NCBI accession no.NP_005882
Quality Level100
shipped inwet ice
species reactivitybovine, human, guinea pig, rat
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q9BWD1
This product has met the following criteria to qualify for the following awards:



PROCEED TO CHECKOUT

HAVE AN ACCOUNT? LOGIN


GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.