Application

Rabbit Anti-ABT1 antibody can be used for IHC (4-8µg/ml) and western blot (1.25µg/ml) applications.

Biochem/physiol Actions

Basal transcription of genes by RNA polymerase II requires the interaction of TATA-binding protein (TBP) with the core region of class II promoters. Studies in mouse suggest that the protein encoded by ABT1 likely activates basal transcription from class II promoters by interaction with TBP and the class II promoter DNA.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

ABT1 is a basal transcription activator that may stimulate class II promoters. ABT1 may also interact with TATA-binding protein (TBP). Rabbit Anti-ABT1 antibody recognizes canine, human, mouse, rat, bovine, and zebrafish ABT1 .

Immunogen

Synthetic peptide directed towards the middle region of human ABT1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: EVAQAKRETDFYLQSVERGQRFLAADGDPARPDGSWTFAQRPTEQELRAR