Application
Rabbit Anti-ZNF394 (AB1) antibody can be used for immunohistochemistry (4-8µg/ml, using paraffin-embedded tissues) and western blot (0.25µg/ml) assays.
Biochem/physiol Actions
ZNF394 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
ZNF394 is a zinc finger protein that can inhibit the transcriptional functions of c-JUN and AP-1. Hence, ZNF394 is known to function as a negative regulator of mitogen-activated protein kinase signaling. ZNF394 may also modulate heart functions. Rabbit Anti-ZNF394 (AB1) antibody binds to human ZNF394 (AB1).
Immunogen
Synthetic peptide directed towards the N terminal region of human ZNF394
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GPWVMAARSKDAAPSQRDGLLPVKVEEDSPGSWEPNYPAASPDPETSRLH
Quantity
Est. Dispatch/Availability