AV30072-100UL Display Image

Anti-ZNF394

Code: AV30072-100UL D2-231

Application

Rabbit Anti-ZNF394 (AB1) antibody can be used for immunohistochemistry (4-8µg/ml, using paraffin-embedded tissues) and western blot (0.25µg/ml) assays.<...


read more

Your Price
€577.00 100UL

Application

Rabbit Anti-ZNF394 (AB1) antibody can be used for immunohistochemistry (4-8µg/ml, using paraffin-embedded tissues) and western blot (0.25µg/ml) assays.

Biochem/physiol Actions

ZNF394 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

ZNF394 is a zinc finger protein that can inhibit the transcriptional functions of c-JUN and AP-1. Hence, ZNF394 is known to function as a negative regulator of mitogen-activated protein kinase signaling. ZNF394 may also modulate heart functions. Rabbit Anti-ZNF394 (AB1) antibody binds to human ZNF394 (AB1).

Immunogen

Synthetic peptide directed towards the N terminal region of human ZNF394

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: GPWVMAARSKDAAPSQRDGLLPVKVEEDSPGSWEPNYPAASPDPETSRLH

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ZNF394(84124)
mol wt64 kDa
NCBI accession no.NP_115540
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q53GI3
Quantity
Est. Dispatch/Availability