Application
Rabbit Anti-ZNF317 antibody is suitable for western blot applications at a concentration of 1 µg/ml.
Biochem/physiol Actions
ZNF317 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 13 C2H2-type zinc fingers and 1 KRAB domain. ZNF317 may function as a transcription factor. It may play an important role in erythroid maturation and lymphoid proliferation.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
ZNF317 is a zinc finger protein involved in the growth of lymphocytes and the maturation of erythroids.Rabbit Anti-ZNF317 antibody recognizes human, and bovine ZNF317.
Immunogen
Synthetic peptide directed towards the C terminal region of human ZNF317
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HRRIHTGEKPYECLVCGKAFSDHSSLRSHVKTHRGEKLFVSSVWKRLQ
This product has met the following criteria to qualify for the following awards: