Anti-ZBTB32

Code: AV31874-100UL D2-231

Application

Rabbit Anti-ZBTB32 antibody can be used for western blot applications at a concentration of 0.5µg/ml.

Biochem/physiol Actions

ZB...


 Read more

Your Price
€432.00 100UL
€531.36 inc. VAT

Application

Rabbit Anti-ZBTB32 antibody can be used for western blot applications at a concentration of 0.5µg/ml.

Biochem/physiol Actions

ZBTB32 may play an essential role during the proliferative stages of primitive hematopoietic progenitors, possibly acting in concert with (a subset of) the Fanconi anemia proteins. This gene can also interact with GATA-2 and can modify GATA-2 transactivation capacity.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

ZBTB32 is a zinc-finger protein that can repress the expression of CIITA and MHC II genes during B cell differentiation. Rabbit Anti-ZBTB32 recognizes bovine, mouse, canine, and human ZBTB32.

Immunogen

Synthetic peptide directed towards the N terminal region of human ZBTB32

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQL

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ZBTB32(27033)
mol wt33 kDa
NCBI accession no.NP_055198
Quality Level100
shipped inwet ice
species reactivityguinea pig, rabbit, human, rat, bovine
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q8WVP2
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.