Application
Rabbit Anti-TRPM5 antibody is suitable for western blot applications at a concentration of 0.5 µg/ml.
Biochem/physiol Actions
TRPM5 is a voltage-modulated Ca(2+)-activated, monovalent cation channel (VCAM) that mediates a transient membrane depolarization and plays a central role in taste transduction. It is activated by arachidonic acid in vitro. It may be involved in perception of bitter, sweet and umami tastes. It may also be involved in sensing semiochemicals.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
TRPM5 is a Ca+-activated channel that is involved in the transduction of umami, sweet and bitter tastes. Voltage, temperature, acidic pH and phosphoinositides are known to modulate TRPM5 function. It regulates mucin secretion in colon and pheromone transduction in olfactory epithelia. TRPM5 has been studied as a target for obesity treatment.Rabbit Anti-TRPM5 antibody recognizes human, canine, and mouse TRPM5.
Immunogen
Synthetic peptide directed towards the N terminal region of human TRPM5
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILV
This product has met the following criteria to qualify for the following awards: