Biochem/physiol Actions

TRIM45 is a member of the tripartite motif family. It may function as a transcriptional repressor of the mitogen-activated protein kinase pathway. Alternatively spliced transcript variants have been described.TRIM45 belongs to a family of tripartite motif (TRIM) proteins that play important roles in a variety of cellular functions, including cell proliferation, differentiation, development, oncogenesis, and apoptosis (Wang et al., 2004 [PubMed 15351693]).[supplied by OMIM].

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human TRIM45

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: EVDPAKCVLQGEDLHRAREKQTASFTLLCKDAAGEIMGRGGDNVQVAVVP