Application

Anti-TMED3 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5µg/mL.

Biochem/physiol Actions

TMED3 (transmembrane emp24 protein transport domain containing 3) gene encodes for single-pass type I membrane protein that belongs to EMP24/GP25L family. It plays a crucial role in vesicular protein trafficking, mainly in the early secretory pathway as well as assists in coupled localization of TMED2 and TMED10 in the cis-Golgi network. P24 protein bind to coat proteins of COPI and COPII vesicles and may facilitate the vesicle biogenesis, cargo uptake and quality control.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human TMED3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: DRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHS