Anti-SYP

Code: SAB2102352-100UL D2-231

Application

Anti-SYP antibody produced in rabbit has been used in western blotting.

Biochem/physiol Actions

Synaptophysin (p38) is an integral me...


 Read more

Your Price
€508.00 100UL
€624.84 inc. VAT

Application

Anti-SYP antibody produced in rabbit has been used in western blotting.

Biochem/physiol Actions

Synaptophysin (p38) is an integral membrane protein of small synaptic vesicles in brain and endocrine cells. Synaptophysin (p38) is an integral membrane protein of small synaptic vesicles in brain and endocrine cells.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human SYP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGE

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SYP(6855)
mol wt34 kDa
Quality Level100
shipped inwet ice
species reactivitygoat, rat, human, guinea pig, bovine, horse, mouse
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.B2R7L6
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.