Application
Rabbit Anti-STRAP antibody is suitable for IHC applications at a dilution of 1:150 and for western blot applications at a concentration of 0.5μg/ml.
Biochem/physiol Actions
The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. STRAP may play a role in the cellular distribution of the SMN complex.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Serine/threonine kinase receptor associated protein (STRAP) is a poly(A) RNA binding protein that modulates type I collagen mRNA translation. It decreases the ubiquitination of Notch3 and negatively regulates ASK1.Rabbit Anti-STRAP antibody recognizes human, mouse, rat, canine, bovine, and zebrafish STRAP.
Immunogen
Synthetic peptide directed towards the N terminal region of human STRAP
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKAL
This product has met the following criteria to qualify for the following awards: