Application

Anti-SMPX polyclonal antibody is used to tag small muscle protein, X-linked for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of small muscle protein, X-linked in maintenance of mechanically stressed cells, such as those associated with the inner ear.

Biochem/physiol Actions

SMPX plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Small muscle protein, X-linked (SMPX), a factor that maintains responsivity to physical force, has been found in hair cells and supporting cells of the inner ear cochlea. SMPX may be important to the long-term maintenance of mechanically stressed inner-ear cells. Defects in SMPX have been associated with X-linked deafness-4.

Immunogen

Synthetic peptide directed towards the middle region of human SMPX

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: TPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ

Specificity

Anti-SMPX polyclonal antibody reacts with mouse, canine, human, rat, bovine, and pig small muscle protein, X-linked proteins.