Application

Anti-SLC43A2 polyclonal antibody is used to tag solute carrier family 43, member 2 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 43, member 2 in transport of tyrosine during fetal gestation.

Biochem/physiol Actions

SLC43A2 is a Sodium-, chloride, pH-independent high affinity transport of large neutral amino acids.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Solute carrier family 43, member 2 (SLC43A2, LAT4) is a system L amino acid transporter that preferentially transports L-tyrosine. Other members of the L amino acid transporter family include LAT1, LAT2 and LAT3. LAT4 may be an important amino acid transporter during gestation wherein it facilitates amino acid transport from the placenta into the fetus.

Immunogen

Synthetic peptide directed towards the N terminal region of human SLC43A2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: TEPENVTNGTVGGTAEPGHEEVSWMNGWLSCQAQDEMLNLAFTVGSFLLS

Specificity

Anti-SLC43A2 polyclonal antibody reacts with bovine, canine, rat, and human solute carrier family 43, member 2 proteins.