Application
Anti-SLC39A5 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5µg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8µg/ml.
Biochem/physiol Actions
SLC39A5 (ZIP5) is a zinc uptake transporter that specifically transports Zn+2 ions. It is expressed in intestine, pancreas, liver and kidney. ZIP5 maintains zinc homeostasis and plays an important role in the uptake of dietary zinc across apical membrane of enterocytes in the intestine. Zinc transport by ZIP5 is important to protect the pancreatic acinar cells against zinc toxicity.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the N terminal region of human SLC39A5
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENG
This product has met the following criteria to qualify for the following awards: