Anti-SFRP1

Code: AV09053-100UL D2-231

Application

Anti-SFRP1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.3 µg/ml.

Biochem/physiol Actions


 Read more

Your Price
€337.00 100UL
€414.51 inc. VAT

Application

Anti-SFRP1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.3 µg/ml.

Biochem/physiol Actions

Secreted Frizzled-related protein 1 (SFRP1) is a secreted antagonist of Wnt signaling pathway. It is secreted in excess amounts during DNA damage- or oxidative stress-induced cellular senescence. SFRP1 is a modulator of normal and malignant hematopoiesis and cell proliferation. Gene polymorphisms, aberrations and methylation of SFRP1 is a feature in bladder cancers resulting in excessive activation of Wnt pathway.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human SFRP1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: HQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPT

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SFRP1(6422)
mol wt35 kDa
NCBI accession no.NP_003003
Quality Level100
shipped inwet ice
species reactivityhorse, dog, guinea pig, human, rat, mouse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q8N474
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.