Application
Rabbit Anti-SEC14L2 antibody can be used for western blot applications at 0.25µg/ml.
Biochem/physiol Actions
SEC14L2 encodes a cytosolic protein which belongs to a family of lipid-binding proteins including Sec14p, alpha-tocopherol transfer protein, and cellular retinol-binding protein. The encoded protein stimulates squalene monooxygenase which is a downstream enzyme in the cholesterol biosynthetic pathway.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
SEC14L2 is a cytosolic protein that belongs to the lipid-binding protein family. This protein is known to activate squalene monooxygenase during the biosynthesis of cholesterol.Rabbit Anti-SEC14L2 antibody recognizes human, mouse, rat, chicken, pig, canine, and bovine SEC14L2.
Immunogen
Synthetic peptide directed towards the middle region of human SEC14L2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEY
This product has met the following criteria to qualify for the following awards: