Application

Rabbit Anti-RSU1 antibody is suitable for western blot applications at a concentration of 1.25 µg/ml and for IHC at 4-8 µg/ml.

Biochem/physiol Actions

RSU1 is a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the protein was initially isolated based on its ability to inhibit v-Ras transformation.This gene encodes a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the encoded protein was initially isolated based on its ability to inhibit v-Ras transformation. Multiple alternatively spliced transcript variants for this gene have been reported; one of these variants was found only in glioma tumors.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

RSU1 codes for a Ras suppressor protein that associates with LIM5 domain of PINCH1 and contributes to adhesion-related functions in cells. It regulates p38 signaling and affects cell survival.Rabbit Anti-RSU1 antibody recognizes chicken, bovine, human, mouse, rat, zebrafish, and canine RSU1.

Immunogen

Synthetic peptide directed towards the C terminal region of human RSU1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRK