Application
Anti-RHOT1 polyclonal antibody is suitable for use in western blotting and immunohistochemical (IHC) techniques. The antibody is used as a probe to determine the role of RHOT1 in calcium-sensitive mitochondrial trafficking.
Biochem/physiol Actions
Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Anti-RHOT1 polyclonal antibody reacts with RHOT1 in chicken, bovine, human, zebrafish, pig, rat, canine, and mouse.
Ras homolog gene family, member T1 (RHOT1, MIRO-1) is an atypical Rho GTPase involved in calcium sensitive mitochondrial trafficking. Miro interacts with the kinesin-binding proteins GRIF-1 and OIP106 forming a link between the mitochondria and the trafficking apparatus of the microtubules. Miro1 and the kinesin adaptor Grif-1 play an important role in regulating mitochondrial transport in neurons. Miro1 is a calcium sensor for glutamate receptor-dependent localization of mitochondria at synapses.
Immunogen
Synthetic peptide directed towards the N terminal region of human RHOT1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER
This product has met the following criteria to qualify for the following awards: