Anti-PTPN1

Code: AV45360-100UL D2-231

Application

Anti-PTPN1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5µg/ml.

Biochem/physiol Actions

...


 Read more

Your Price
€463.00 100UL
€569.49 inc. VAT

Application

Anti-PTPN1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5µg/ml.

Biochem/physiol Actions

Protein tyrosine phosphatase, non-receptor type 1 (PTPN1) is the first member of protein tyrosine phosphatase (PTP) family to be identified. The members of this family are involved in cell growth, differentiation and mitosis. PTPN1 dephosphorylates insulin receptor, JAK2 and TYK2 kinases and negatively regulates cell signaling mediated by these proteins.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human PTPN1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVL

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... PTPN1(5770)
mol wt50 kDa
NCBI accession no.NP_002818
Quality Level100
shipped inwet ice
species reactivityrat, bovine, mouse, guinea pig, horse, human, dog
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P18031
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.