Application

Rabbit Anti-PSMD14 antibody can be used for western blot applications at a concentration of 0.5µg/ml.

Biochem/physiol Actions

POH1 (pad one homolog-1) is a component of the 26S proteasome, a multiprotein complex that degrades proteins targeted for destruction by the ubiquitin pathway

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

PSMD14 is a part of the 19S complex that mediates the deubiquitination of substrates during proteasomal degradation. This protein is known to mediate senescence and cell cycle arrest.Rabbit Anti-PSMD14 recognizes human, mouse, rat, bovine, and zebrafish PSMD14.

Immunogen

Synthetic peptide directed towards the C terminal region of human PSMD14

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: EEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK