Application
Anti-PPIF antibody produced in rabbit is suitable for western blotting at a concentration of 5µg/ml.
Biochem/physiol Actions
PPIF (peptidylprolyl isomerase F) also referred to as CypD or cyclophilin F belongs to peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases are highly-conserved cytoplasmic enzymes that accelerate protein folding. PPIF is a part of the mitochondrial permeability transition pore (mPTP) in the inner mitochondrial membrane. Hence, it is anticipated that its association with the mPTP masks the binding site for inhibiting inorganic phosphate (Pi) as well as enhances the open possibility of mPTP that results in apoptosis or necrosis.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the middle region of human PPIF
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS
This product has met the following criteria to qualify for the following awards: