Anti-PLD3

Code: AV44768-100UL D2-231

Application

Anti-PLD3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5µg/ml.

Biochem/physiol Actions

P...


 Read more

Your Price
€432.00 100UL
€531.36 inc. VAT

Application

Anti-PLD3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5µg/ml.

Biochem/physiol Actions

Phospholipase D (PLD) family, member 3 belongs to the PLD family of enzymes that hydrolyze the membrane phospholipids. PLD3 is associated with the endoplasmic reticulum and is expressed in a variety of tissues and cells. The expression of PLD3 increases drastically in neurons and muscle cells during differentiation. PLD3 is involved in the processing of amyloid-beta precursor protein and myogenesis during the formation of the myotube.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human PLD3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... PLD3(23646)
mol wt55 kDa
NCBI accession no.NP_036400
Quality Level100
shipped inwet ice
species reactivityhuman, dog, guinea pig, mouse, bovine, horse, rabbit, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q8IV08
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.