Application
Anti-PEG3 polyclonal antibody is used to tag paternally expressed 3 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of paternally expressed 3 in genomic imprinting of male sexual behaviour, as a marker for competent self-renewing stem cells and in p53-mediated cell death.
Biochem/physiol Actions
PEG3 induces apoptosis in cooperation with SIAH1A and acts as a mediator between TP53/p53 and BAX in a neuronal death pathway that is activated by DNA damage. PEG3 acts synergistically with TRAF2 and inhibits TNF induced apoptosis through activation of NF-kappa-B. PEG3 also possesses a tumor suppressing activity in glioma cells.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Paternally expressed 3 (PEG3, PW1) is involved in maternal genomic imprinting that is paternally expressed. Paternal expression of PEG3 regulates sexually experience effects on male behavior in mammals involving display of sexual behavior, aggression, and olfaction. PEGS reglulates sexual experience dependent preferences for estrous odors. PW1 identifies multiple adult stem and progenitor cell populations and serves as a marker for competent self-renewing stem cells in a wide array of adult tissues. Peg3/Pw1 is involved in the p53-mediated cell death pathway as a downstream effector of p53 in brain ischemia/hypoxia.
Immunogen
Synthetic peptide directed towards the C terminal region of human PEG3
Sequence
Synthetic peptide located within the following region: FGECSGYIERASTSTGGANQADEKYFKCDVCGQLFNDRLSLARHQNTHTG
Specificity
Anti-PEG3 polyclonal antibody reacts with bovine, canine, pig, human, mouse, rat paternally expressed 3 proteins.
This product has met the following criteria to qualify for the following awards: