Biochem/physiol Actions
Phosphodiesterase 9A (PDE9A) is a high-affinity, cGMP-specific enzyme. It belongs to an important protein family that catalyzes the hydrolysis of cyclic nucleotide monophosphates (cAMP and cGMP). The members of this family are also secondary intracellular messengers responsible for transducing a variety of extra-cellular signals.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the N terminal region of human PDE9A
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPET
This product has met the following criteria to qualify for the following awards: