Anti-OVOL1

Code: AV38500-100UL D2-231

Biochem/physiol Actions

OVOL1 is a protein highly similar to Drosophila and mouse proteins. In Drosophila the ovo protein plays a critical role in Drosophila oogenesis and cu...


 Read more

Your Price
€297.00 100UL
€365.31 inc. VAT

Biochem/physiol Actions

OVOL1 is a protein highly similar to Drosophila and mouse proteins. In Drosophila the ovo protein plays a critical role in Drosophila oogenesis and cuticle formation. In mice the ovo like protein is involved in hair formation and spermatogenesis. The function of the human gene product has not been determined.This gene encodes a protein highly similar to Drosophila and mouse proteins. In Drosophila the ovo protein plays a critical role in Drosophila oogenesis and cuticle formation. In mice the ovo like protein is involved in hair formation and spermatogenesis. The function of the human gene product has not been determined.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human OVOL1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: QKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVA

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... OVOL1(5017)
mol wt30 kDa
NCBI accession no.NP_004552
Quality Level100
shipped inwet ice
species reactivityrat, goat, bovine, human, guinea pig, dog, horse
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.O14753
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.