Biochem/physiol Actions

In B lymphocytes, OTUD6B (OTU domain containing 6B) negatively regulates cell proliferation. In transgenic mouse (TgMMTV-neu) model, OTUD6B autoantibodies were detected prior to the development of breast cancer and might be used for the early human cancer detection.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

The gene OTUD6B (OTU domain containing 6B) is mapped to human chromosome 8q21. The encoded protein belongs to the OTU (ovarian tumor) family of proteins. OTUD6B is a deubiquitinating enzyme which can be induced by cytokines.

Immunogen

Synthetic peptide directed towards the middle region of human OTUD6B

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: EIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENC