Application

Rabbit Anti-OSR2 antibody can be used for western blot assays at a concentration of 0.5µg/ml.

Rabbit polyclonal anti-OSR2 antibody is used to tag odd-skipped related 2 (Drosophila) for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of odd-skipped related 2 (Drosophila) in the development and patterning of craniofacial structures.

Biochem/physiol Actions

Osr2 is a zinc finger containing protein related to Drosophila Odd-skipped. Its mRNA expression is specifically activated in the nascent palatal mesenchyme at the onset of palatal outgrowth. Osr2 mutants exhibit altered gene expression patterns, including those of Osr1, Pax9 and Tgfb3, during palate development.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Rabbit polyclonal anti-OSR2 antibody reacts with bovine, human, mouse, rat, canine, and chicken odd-skipped related 2 (Drosophila) transcription factors..

Odd-skipped related 2 (Drosophila) (OSR2) is a zinc finger transcription factor expressed during craniofacial development, in the mandibular and maxillary processes as well as the developing palate. Osr2 acts as a key intrinsic regulator of palatal growth and patterning. Antagonistic actions of Msx1 and Osr2 pattern mammalian teeth into a single row.

Immunogen

Synthetic peptide directed towards the N terminal region of human OSR2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: YSFLQAVNTFPATVDHLQGLYGLSAVQTMHMNHWTLGYPNVHEITRSTIT