Application

Anti-NUP155 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Biochem/physiol Actions

Nucleoporins are the main components of nuclear pore complexes (NPCs) involved both in binding and translocating proteins during nucleocytoplasmic transport. It plays a crucial role in the assembly and functioning of the NPCs that govern the movement of macromolecules across the nuclear envelope (NE). Loss of function mutation in NUP155 results in atrial fibrillation and cardiovascular disease.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Nuclear pore complex protein Nup155 is a protein encoded by the NUP155 gene in humans. NUP155 (nucleoporin 155kDa) gene encodes a peripheral membrane protein nucleoporin that belongs to non-repetitive/WGA-negative nucleoporin family. It is localized on to chromosome band 5p13. It is expressed in most tissues, including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.

Immunogen

Synthetic peptide directed towards the middle region of human NUP155

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: ISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRESLKEY