Application
Rabbit Anti-NR5A2 (AB2) antibody can be used for western blot applications at a concentration of 1µg/ml.
Biochem/physiol Actions
NR5A2 binds to the sequence element 5′-AACGACCGACCTTGAG-3′ of the enhancer II of hepatitis B virus genes, a critical cis-element of their expression and regulation. It may be responsable for the liver-specific activity of enhancer II, probably in combination with other hepatocyte transcription factors. It is a key regulator of cholesterol 7-alpha-hydroxylase gene (CYP7A) expression in liver. It may also contribute to the regulation of pancreas-specific genes and play important roles in embryonic development.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
NR5A2 belongs to the nuclear receptor subfamily. It has been implicated in acinar cell differentiation and pancreatic carcinogenesis.Rabbit Anti-NR5A2 (AB2) antibody recognizes chicken, human, mouse, and rat NR5A2.
Immunogen
Synthetic peptide directed towards the middle region of human NR5A2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LPPTDYDRSPFVTSPISMTMLHGSLQGYQTYGHFPSRAIKSEYPDPYTSS
This product has met the following criteria to qualify for the following awards: