Biochem/physiol Actions

NEURL2 contains 1 NHR (neuralized homology repeat) domain and 1 SOCS box domain. NEURL2 plays an important role in the process of myofiber differentiation and maturation. NEURL2 is the probable substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex, which mediates the ubiquitination of proteins. NEURL2 probably contributes to catalysis through recognition and positioning of the substrate and the ubiquitin-conjugating enzyme. During myogenesis, it controls the ubiquitination and degradation of the specific pool of CTNNB1/beta-catenin located at the sarcolemma.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human NEURL2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MAAASEPVDSGALWGLERPEPPPTRFHRVHGANIRVDPSGTRATRVESFA