Application

Rabbit Anti-NEK6 antibody is suitable for western blot concentration of 1µg/ml.

Biochem/physiol Actions

The Aspergillus nidulans ′never in mitosis A′ (NIMA) gene encodes a serine/threonine kinase that controls initiation of mitosis. NIMA-related kinases (NEKs) are a group of protein kinases that are homologous to NIMA. Evidence suggests that NEKs perform functions similar to those of NIMA.The Aspergillus nidulans ′never in mitosis A′ (NIMA) gene encodes a serine/threonine kinase that controls initiation of mitosis. NIMA-related kinases (NEKs) are a group of protein kinases that are homologous to NIMA. Evidence suggests that NEKs perform functions similar to those of NIMA.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

NEK6 codes for NIMA-related kinase 6 that is involved in cytokinesis and mitotic spindle formation. It is activated by Nek9 and is known to phosphorylate Eg5 during cell signaling cascades.Rabbit Anti-NEK6 antibody recognizes canine, chicken, zebrafish, human, mouse, rat, bovine, and pig NEK6.

Immunogen

Synthetic peptide directed towards the N terminal region of human NEK6

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: FRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKAR