Anti-MYC

Application

Protein lysates of mouse forebrains were analyzed by western blot using rabbit anti-myc. In addition, immunocytochemistry of PC12 cells fixed in 4% paraformaldhyde was performed using rabbit anti-myc at a 1:500 dilution and 4 degrees incubation overnight.

Biochem/physiol Actions

MyC is an immediate early response protein that is regulated by multiple signal transduction pathways. It is a highly amplified oncogene in many human cancers and is commonly found altered by chromosomal translocations. MyC plays a role in tumor initiation, proliferation of cells and tumor maintenance.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human MYC

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: APKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA